Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 1892576..1893386 | Replicon | chromosome |
Accession | NZ_CP121141 | ||
Organism | Klebsiella pneumoniae strain UHD-58_PH |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A060VJ83 |
Locus tag | P8T47_RS09190 | Protein ID | WP_004178461.1 |
Coordinates | 1892853..1893386 (+) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | P8T47_RS09185 | Protein ID | WP_002887278.1 |
Coordinates | 1892576..1892842 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8T47_RS09165 (P8T47_09165) | 1888447..1888791 | - | 345 | WP_116288284.1 | cation efflux system protein CusF | - |
P8T47_RS09170 (P8T47_09170) | 1888809..1890194 | - | 1386 | WP_026005908.1 | efflux transporter outer membrane subunit | - |
P8T47_RS09175 (P8T47_09175) | 1890367..1891050 | + | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
P8T47_RS09180 (P8T47_09180) | 1891040..1892473 | + | 1434 | WP_032415907.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
P8T47_RS09185 (P8T47_09185) | 1892576..1892842 | + | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
P8T47_RS09190 (P8T47_09190) | 1892853..1893386 | + | 534 | WP_004178461.1 | type II toxin-antitoxin system toxin KacT | Toxin |
P8T47_RS09195 (P8T47_09195) | 1893434..1894555 | - | 1122 | WP_012737335.1 | cupin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19810.65 Da Isoelectric Point: 5.2614
>T275814 WP_004178461.1 NZ_CP121141:1892853-1893386 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VJ83 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |