Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1778281..1778797 | Replicon | chromosome |
Accession | NZ_CP121141 | ||
Organism | Klebsiella pneumoniae strain UHD-58_PH |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | P8T47_RS08715 | Protein ID | WP_004178374.1 |
Coordinates | 1778513..1778797 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | P8T47_RS08710 | Protein ID | WP_002886901.1 |
Coordinates | 1778281..1778523 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8T47_RS08695 (P8T47_08695) | 1774309..1775049 | + | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
P8T47_RS08700 (P8T47_08700) | 1775116..1776270 | + | 1155 | WP_032415878.1 | lactonase family protein | - |
P8T47_RS08705 (P8T47_08705) | 1776293..1778203 | + | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
P8T47_RS08710 (P8T47_08710) | 1778281..1778523 | + | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
P8T47_RS08715 (P8T47_08715) | 1778513..1778797 | + | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P8T47_RS08720 (P8T47_08720) | 1778801..1779265 | - | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
P8T47_RS08725 (P8T47_08725) | 1779594..1781732 | - | 2139 | WP_032415880.1 | anaerobic ribonucleoside-triphosphate reductase | - |
P8T47_RS08730 (P8T47_08730) | 1782089..1782832 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
P8T47_RS08735 (P8T47_08735) | 1782835..1783008 | - | 174 | WP_004222159.1 | hypothetical protein | - |
P8T47_RS08740 (P8T47_08740) | 1783093..1783401 | + | 309 | WP_002886907.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T275813 WP_004178374.1 NZ_CP121141:1778513-1778797 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |