Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 1296305..1296930 | Replicon | chromosome |
| Accession | NZ_CP121141 | ||
| Organism | Klebsiella pneumoniae strain UHD-58_PH | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A378FVD4 |
| Locus tag | P8T47_RS06405 | Protein ID | WP_019705794.1 |
| Coordinates | 1296547..1296930 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | P8T47_RS06400 | Protein ID | WP_004150355.1 |
| Coordinates | 1296305..1296547 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8T47_RS06375 (P8T47_06375) | 1292296..1292895 | + | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
| P8T47_RS06380 (P8T47_06380) | 1292889..1293749 | + | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| P8T47_RS06385 (P8T47_06385) | 1293746..1294183 | + | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| P8T47_RS06390 (P8T47_06390) | 1294228..1295169 | + | 942 | WP_012543287.1 | fatty acid biosynthesis protein FabY | - |
| P8T47_RS06395 (P8T47_06395) | 1295183..1296100 | - | 918 | WP_012737090.1 | alpha/beta hydrolase | - |
| P8T47_RS06400 (P8T47_06400) | 1296305..1296547 | + | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| P8T47_RS06405 (P8T47_06405) | 1296547..1296930 | + | 384 | WP_019705794.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P8T47_RS06410 (P8T47_06410) | 1297104..1298033 | - | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| P8T47_RS06415 (P8T47_06415) | 1298030..1298665 | - | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P8T47_RS06420 (P8T47_06420) | 1298662..1299564 | - | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14358.57 Da Isoelectric Point: 6.8806
>T275811 WP_019705794.1 NZ_CP121141:1296547-1296930 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A378FVD4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |