Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 421501..422158 | Replicon | chromosome |
Accession | NZ_CP121141 | ||
Organism | Klebsiella pneumoniae strain UHD-58_PH |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | P8T47_RS02085 | Protein ID | WP_002916310.1 |
Coordinates | 421501..421911 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | P8T47_RS02090 | Protein ID | WP_002916312.1 |
Coordinates | 421892..422158 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8T47_RS02065 (P8T47_02065) | 417501..419234 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
P8T47_RS02070 (P8T47_02070) | 419240..419953 | - | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P8T47_RS02075 (P8T47_02075) | 419976..420872 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
P8T47_RS02080 (P8T47_02080) | 420973..421494 | + | 522 | WP_004144730.1 | flavodoxin FldB | - |
P8T47_RS02085 (P8T47_02085) | 421501..421911 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
P8T47_RS02090 (P8T47_02090) | 421892..422158 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
P8T47_RS02095 (P8T47_02095) | 422404..423387 | + | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
P8T47_RS02100 (P8T47_02100) | 423538..424197 | - | 660 | WP_002916317.1 | hemolysin III family protein | - |
P8T47_RS02105 (P8T47_02105) | 424361..424672 | - | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
P8T47_RS02110 (P8T47_02110) | 424722..425450 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
P8T47_RS02115 (P8T47_02115) | 425569..427002 | + | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T275807 WP_002916310.1 NZ_CP121141:c421911-421501 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |