Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 100211..100947 Replicon plasmid pESBL-PH-4
Accession NZ_CP121140
Organism Klebsiella pneumoniae strain UHD-4_PH

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag P8T35_RS26310 Protein ID WP_003026803.1
Coordinates 100211..100693 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag P8T35_RS26315 Protein ID WP_003026799.1
Coordinates 100681..100947 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T35_RS26285 (P8T35_26285) 95286..95774 + 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -
P8T35_RS26290 (P8T35_26290) 95761..96723 + 963 WP_004152113.1 zinc metalloprotease HtpX -
P8T35_RS26295 (P8T35_26295) 96900..98065 + 1166 Protein_106 IS3 family transposase -
P8T35_RS26300 (P8T35_26300) 98213..98608 - 396 WP_004143398.1 helix-turn-helix domain-containing protein -
P8T35_RS26305 (P8T35_26305) 98657..100003 - 1347 WP_077253535.1 ISNCY family transposase -
P8T35_RS26310 (P8T35_26310) 100211..100693 - 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
P8T35_RS26315 (P8T35_26315) 100681..100947 - 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
P8T35_RS26320 (P8T35_26320) 101123..101377 - 255 WP_004152108.1 hypothetical protein -
P8T35_RS26325 (P8T35_26325) 101453..101710 - 258 WP_004152107.1 hypothetical protein -
P8T35_RS26330 (P8T35_26330) 101759..101962 - 204 WP_004152106.1 HHA domain-containing protein -
P8T35_RS26335 (P8T35_26335) 101996..102364 - 369 WP_004152105.1 hypothetical protein -
P8T35_RS26340 (P8T35_26340) 102408..102902 - 495 WP_004152104.1 DNA-binding protein -
P8T35_RS26345 (P8T35_26345) 102933..103508 - 576 WP_004152103.1 hypothetical protein -
P8T35_RS26350 (P8T35_26350) 103496..103765 - 270 WP_004152102.1 hypothetical protein -
P8T35_RS26355 (P8T35_26355) 104123..104473 + 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
P8T35_RS26360 (P8T35_26360) 104523..104885 + 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid dfrA14 / qnrB1 / tet(A) / aac(6')-Ib-cr / blaOXA-1 / aac(3)-IIa / blaCTX-M-15 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 - 1..192395 192395


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T275806 WP_003026803.1 NZ_CP121140:c100693-100211 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT275806 WP_003026799.1 NZ_CP121140:c100947-100681 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References