Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5102888..5103513 | Replicon | chromosome |
| Accession | NZ_CP121139 | ||
| Organism | Klebsiella pneumoniae strain UHD-4_PH | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A378FVD4 |
| Locus tag | P8T35_RS24740 | Protein ID | WP_019705794.1 |
| Coordinates | 5103130..5103513 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | P8T35_RS24735 | Protein ID | WP_004150355.1 |
| Coordinates | 5102888..5103130 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8T35_RS24710 (P8T35_24710) | 5098879..5099478 | + | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
| P8T35_RS24715 (P8T35_24715) | 5099472..5100332 | + | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| P8T35_RS24720 (P8T35_24720) | 5100329..5100766 | + | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| P8T35_RS24725 (P8T35_24725) | 5100811..5101752 | + | 942 | WP_012543287.1 | fatty acid biosynthesis protein FabY | - |
| P8T35_RS24730 (P8T35_24730) | 5101766..5102683 | - | 918 | WP_012737090.1 | alpha/beta hydrolase | - |
| P8T35_RS24735 (P8T35_24735) | 5102888..5103130 | + | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| P8T35_RS24740 (P8T35_24740) | 5103130..5103513 | + | 384 | WP_019705794.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P8T35_RS24745 (P8T35_24745) | 5103687..5104616 | - | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| P8T35_RS24750 (P8T35_24750) | 5104613..5105248 | - | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P8T35_RS24755 (P8T35_24755) | 5105245..5106147 | - | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14358.57 Da Isoelectric Point: 6.8806
>T275805 WP_019705794.1 NZ_CP121139:5103130-5103513 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A378FVD4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |