Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4227360..4228017 | Replicon | chromosome |
| Accession | NZ_CP121139 | ||
| Organism | Klebsiella pneumoniae strain UHD-4_PH | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | P8T35_RS20420 | Protein ID | WP_002916310.1 |
| Coordinates | 4227360..4227770 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | P8T35_RS20425 | Protein ID | WP_002916312.1 |
| Coordinates | 4227751..4228017 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8T35_RS20400 (P8T35_20400) | 4223360..4225093 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| P8T35_RS20405 (P8T35_20405) | 4225099..4225812 | - | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| P8T35_RS20410 (P8T35_20410) | 4225835..4226731 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| P8T35_RS20415 (P8T35_20415) | 4226832..4227353 | + | 522 | WP_004144730.1 | flavodoxin FldB | - |
| P8T35_RS20420 (P8T35_20420) | 4227360..4227770 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
| P8T35_RS20425 (P8T35_20425) | 4227751..4228017 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| P8T35_RS20430 (P8T35_20430) | 4228263..4229246 | + | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
| P8T35_RS20435 (P8T35_20435) | 4229397..4230056 | - | 660 | WP_002916317.1 | hemolysin III family protein | - |
| P8T35_RS20440 (P8T35_20440) | 4230220..4230531 | - | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
| P8T35_RS20445 (P8T35_20445) | 4230581..4231309 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| P8T35_RS20450 (P8T35_20450) | 4231428..4232861 | + | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T275801 WP_002916310.1 NZ_CP121139:c4227770-4227360 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |