Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 993733..994352 | Replicon | chromosome |
Accession | NZ_CP121139 | ||
Organism | Klebsiella pneumoniae strain UHD-4_PH |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | P8T35_RS04705 | Protein ID | WP_002892050.1 |
Coordinates | 993733..993951 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | P8T35_RS04710 | Protein ID | WP_002892066.1 |
Coordinates | 993978..994352 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8T35_RS04670 (P8T35_04670) | 989780..990043 | + | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
P8T35_RS04675 (P8T35_04675) | 990043..990183 | + | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
P8T35_RS04680 (P8T35_04680) | 990180..990878 | - | 699 | WP_032414604.1 | GNAT family protein | - |
P8T35_RS04685 (P8T35_04685) | 990979..992430 | + | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
P8T35_RS04690 (P8T35_04690) | 992405..992875 | - | 471 | WP_002892026.1 | YlaC family protein | - |
P8T35_RS04695 (P8T35_04695) | 992896..993036 | + | 141 | WP_004147370.1 | hypothetical protein | - |
P8T35_RS04700 (P8T35_04700) | 993008..993574 | - | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
P8T35_RS04705 (P8T35_04705) | 993733..993951 | - | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
P8T35_RS04710 (P8T35_04710) | 993978..994352 | - | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
P8T35_RS04715 (P8T35_04715) | 994838..997984 | - | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
P8T35_RS04720 (P8T35_04720) | 998007..999200 | - | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T275795 WP_002892050.1 NZ_CP121139:c993951-993733 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT275795 WP_002892066.1 NZ_CP121139:c994352-993978 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |