Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 267426..267942 | Replicon | chromosome |
Accession | NZ_CP121139 | ||
Organism | Klebsiella pneumoniae strain UHD-4_PH |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | P8T35_RS01290 | Protein ID | WP_004178374.1 |
Coordinates | 267658..267942 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | P8T35_RS01285 | Protein ID | WP_002886901.1 |
Coordinates | 267426..267668 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8T35_RS01270 (P8T35_01270) | 263454..264194 | + | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
P8T35_RS01275 (P8T35_01275) | 264261..265415 | + | 1155 | WP_032415878.1 | lactonase family protein | - |
P8T35_RS01280 (P8T35_01280) | 265438..267348 | + | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
P8T35_RS01285 (P8T35_01285) | 267426..267668 | + | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
P8T35_RS01290 (P8T35_01290) | 267658..267942 | + | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P8T35_RS01295 (P8T35_01295) | 267946..268410 | - | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
P8T35_RS01300 (P8T35_01300) | 268739..270877 | - | 2139 | WP_032415880.1 | anaerobic ribonucleoside-triphosphate reductase | - |
P8T35_RS01305 (P8T35_01305) | 271234..271977 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
P8T35_RS01310 (P8T35_01310) | 271980..272153 | - | 174 | WP_004222159.1 | hypothetical protein | - |
P8T35_RS01315 (P8T35_01315) | 272283..272546 | + | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T275793 WP_004178374.1 NZ_CP121139:267658-267942 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |