Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 126736..127472 Replicon plasmid pESBL-PH-33
Accession NZ_CP121138
Organism Klebsiella pneumoniae strain UHD-33_PH

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag P8T49_RS26465 Protein ID WP_003026803.1
Coordinates 126990..127472 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag P8T49_RS26460 Protein ID WP_003026799.1
Coordinates 126736..127002 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T49_RS26415 (P8T49_26410) 122798..123160 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
P8T49_RS26420 (P8T49_26415) 123210..123560 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
P8T49_RS26425 (P8T49_26420) 123918..124187 + 270 WP_004152102.1 hypothetical protein -
P8T49_RS26430 (P8T49_26425) 124175..124750 + 576 WP_004152103.1 hypothetical protein -
P8T49_RS26435 (P8T49_26430) 124781..125275 + 495 WP_004152104.1 DNA-binding protein -
P8T49_RS26440 (P8T49_26435) 125319..125687 + 369 WP_004152105.1 hypothetical protein -
P8T49_RS26445 (P8T49_26440) 125721..125924 + 204 WP_004152106.1 HHA domain-containing protein -
P8T49_RS26450 (P8T49_26445) 125973..126230 + 258 WP_004152107.1 hypothetical protein -
P8T49_RS26455 (P8T49_26450) 126306..126560 + 255 WP_004152108.1 hypothetical protein -
P8T49_RS26460 (P8T49_26455) 126736..127002 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
P8T49_RS26465 (P8T49_26460) 126990..127472 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
P8T49_RS26470 (P8T49_26465) 127680..129026 + 1347 WP_077253535.1 ISNCY family transposase -
P8T49_RS26475 (P8T49_26470) 129075..129470 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
P8T49_RS26480 (P8T49_26475) 129618..130783 - 1166 Protein_139 IS3 family transposase -
P8T49_RS26485 (P8T49_26480) 130960..131922 - 963 WP_004152113.1 zinc metalloprotease HtpX -
P8T49_RS26490 (P8T49_26485) 131909..132397 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / dfrA14 / qnrB1 / tet(A) / aac(6')-Ib-cr / blaOXA-1 / aac(3)-IIa - 1..247159 247159


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T275791 WP_003026803.1 NZ_CP121138:126990-127472 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT275791 WP_003026799.1 NZ_CP121138:126736-127002 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References