Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 126736..127472 | Replicon | plasmid pESBL-PH-33 |
| Accession | NZ_CP121138 | ||
| Organism | Klebsiella pneumoniae strain UHD-33_PH | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | P8T49_RS26465 | Protein ID | WP_003026803.1 |
| Coordinates | 126990..127472 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | P8T49_RS26460 | Protein ID | WP_003026799.1 |
| Coordinates | 126736..127002 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8T49_RS26415 (P8T49_26410) | 122798..123160 | - | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
| P8T49_RS26420 (P8T49_26415) | 123210..123560 | - | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| P8T49_RS26425 (P8T49_26420) | 123918..124187 | + | 270 | WP_004152102.1 | hypothetical protein | - |
| P8T49_RS26430 (P8T49_26425) | 124175..124750 | + | 576 | WP_004152103.1 | hypothetical protein | - |
| P8T49_RS26435 (P8T49_26430) | 124781..125275 | + | 495 | WP_004152104.1 | DNA-binding protein | - |
| P8T49_RS26440 (P8T49_26435) | 125319..125687 | + | 369 | WP_004152105.1 | hypothetical protein | - |
| P8T49_RS26445 (P8T49_26440) | 125721..125924 | + | 204 | WP_004152106.1 | HHA domain-containing protein | - |
| P8T49_RS26450 (P8T49_26445) | 125973..126230 | + | 258 | WP_004152107.1 | hypothetical protein | - |
| P8T49_RS26455 (P8T49_26450) | 126306..126560 | + | 255 | WP_004152108.1 | hypothetical protein | - |
| P8T49_RS26460 (P8T49_26455) | 126736..127002 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| P8T49_RS26465 (P8T49_26460) | 126990..127472 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| P8T49_RS26470 (P8T49_26465) | 127680..129026 | + | 1347 | WP_077253535.1 | ISNCY family transposase | - |
| P8T49_RS26475 (P8T49_26470) | 129075..129470 | + | 396 | WP_004143398.1 | helix-turn-helix domain-containing protein | - |
| P8T49_RS26480 (P8T49_26475) | 129618..130783 | - | 1166 | Protein_139 | IS3 family transposase | - |
| P8T49_RS26485 (P8T49_26480) | 130960..131922 | - | 963 | WP_004152113.1 | zinc metalloprotease HtpX | - |
| P8T49_RS26490 (P8T49_26485) | 131909..132397 | - | 489 | WP_004152114.1 | phosphate-starvation-inducible PsiE family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / dfrA14 / qnrB1 / tet(A) / aac(6')-Ib-cr / blaOXA-1 / aac(3)-IIa | - | 1..247159 | 247159 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T275791 WP_003026803.1 NZ_CP121138:126990-127472 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |