Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2816807..2817426 Replicon chromosome
Accession NZ_CP121137
Organism Klebsiella pneumoniae strain UHD-33_PH

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag P8T49_RS13670 Protein ID WP_002892050.1
Coordinates 2817208..2817426 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag P8T49_RS13665 Protein ID WP_002892066.1
Coordinates 2816807..2817181 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T49_RS13655 (P8T49_13655) 2811959..2813152 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
P8T49_RS13660 (P8T49_13660) 2813175..2816321 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
P8T49_RS13665 (P8T49_13665) 2816807..2817181 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
P8T49_RS13670 (P8T49_13670) 2817208..2817426 + 219 WP_002892050.1 HHA domain-containing protein Toxin
P8T49_RS13675 (P8T49_13675) 2817585..2818151 + 567 WP_002892030.1 maltose O-acetyltransferase -
P8T49_RS13680 (P8T49_13680) 2818123..2818263 - 141 WP_004147370.1 hypothetical protein -
P8T49_RS13685 (P8T49_13685) 2818284..2818754 + 471 WP_002892026.1 YlaC family protein -
P8T49_RS13690 (P8T49_13690) 2818729..2820180 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
P8T49_RS13695 (P8T49_13695) 2820281..2820979 + 699 WP_032414604.1 GNAT family protein -
P8T49_RS13700 (P8T49_13700) 2820976..2821116 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
P8T49_RS13705 (P8T49_13705) 2821116..2821379 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T275782 WP_002892050.1 NZ_CP121137:2817208-2817426 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT275782 WP_002892066.1 NZ_CP121137:2816807-2817181 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References