Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 158470..159206 Replicon plasmid pESBL-PH-41
Accession NZ_CP121136
Organism Klebsiella pneumoniae strain UHD-41_PH

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag P8T41_RS26625 Protein ID WP_003026803.1
Coordinates 158724..159206 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag P8T41_RS26620 Protein ID WP_003026799.1
Coordinates 158470..158736 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T41_RS26575 (P8T41_26570) 154532..154894 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
P8T41_RS26580 (P8T41_26575) 154944..155294 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
P8T41_RS26585 (P8T41_26580) 155652..155921 + 270 WP_004152102.1 hypothetical protein -
P8T41_RS26590 (P8T41_26585) 155909..156484 + 576 WP_004152103.1 hypothetical protein -
P8T41_RS26595 (P8T41_26590) 156515..157009 + 495 WP_004152104.1 DNA-binding protein -
P8T41_RS26600 (P8T41_26595) 157053..157421 + 369 WP_004152105.1 hypothetical protein -
P8T41_RS26605 (P8T41_26600) 157455..157658 + 204 WP_004152106.1 HHA domain-containing protein -
P8T41_RS26610 (P8T41_26605) 157707..157964 + 258 WP_004152107.1 hypothetical protein -
P8T41_RS26615 (P8T41_26610) 158040..158294 + 255 WP_004152108.1 hypothetical protein -
P8T41_RS26620 (P8T41_26615) 158470..158736 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
P8T41_RS26625 (P8T41_26620) 158724..159206 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
P8T41_RS26630 (P8T41_26625) 159414..160759 + 1346 Protein_172 ISNCY family transposase -
P8T41_RS26635 (P8T41_26630) 160808..161203 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
P8T41_RS26640 (P8T41_26635) 161351..162516 - 1166 Protein_174 IS3 family transposase -
P8T41_RS26645 (P8T41_26640) 162693..163655 - 963 WP_004152113.1 zinc metalloprotease HtpX -
P8T41_RS26650 (P8T41_26645) 163642..164130 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / tet(A) / qnrB1 / dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 - 1..247177 247177


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T275776 WP_003026803.1 NZ_CP121136:158724-159206 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT275776 WP_003026799.1 NZ_CP121136:158470-158736 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References