Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2504553..2505172 Replicon chromosome
Accession NZ_CP121135
Organism Klebsiella pneumoniae strain UHD-41_PH

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag P8T41_RS12130 Protein ID WP_002892050.1
Coordinates 2504553..2504771 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag P8T41_RS12135 Protein ID WP_002892066.1
Coordinates 2504798..2505172 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T41_RS12095 (P8T41_12095) 2500600..2500863 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
P8T41_RS12100 (P8T41_12100) 2500863..2501003 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
P8T41_RS12105 (P8T41_12105) 2501000..2501698 - 699 WP_032414604.1 GNAT family protein -
P8T41_RS12110 (P8T41_12110) 2501799..2503250 + 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
P8T41_RS12115 (P8T41_12115) 2503225..2503695 - 471 WP_002892026.1 YlaC family protein -
P8T41_RS12120 (P8T41_12120) 2503716..2503856 + 141 WP_004147370.1 hypothetical protein -
P8T41_RS12125 (P8T41_12125) 2503828..2504394 - 567 WP_002892030.1 maltose O-acetyltransferase -
P8T41_RS12130 (P8T41_12130) 2504553..2504771 - 219 WP_002892050.1 HHA domain-containing protein Toxin
P8T41_RS12135 (P8T41_12135) 2504798..2505172 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
P8T41_RS12140 (P8T41_12140) 2505658..2508804 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
P8T41_RS12145 (P8T41_12145) 2508827..2510020 - 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T275770 WP_002892050.1 NZ_CP121135:c2504771-2504553 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT275770 WP_002892066.1 NZ_CP121135:c2505172-2504798 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References