Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1018439..1019178 | Replicon | chromosome |
Accession | NZ_CP121135 | ||
Organism | Klebsiella pneumoniae strain UHD-41_PH |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | P8T41_RS05065 | Protein ID | WP_032415800.1 |
Coordinates | 1018439..1018924 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | P8T41_RS05070 | Protein ID | WP_003026799.1 |
Coordinates | 1018912..1019178 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8T41_RS05040 (P8T41_05040) | 1013567..1014922 | + | 1356 | WP_032415797.1 | aromatic acid/H+ symport family MFS transporter | - |
P8T41_RS05045 (P8T41_05045) | 1015168..1015458 | + | 291 | WP_002921931.1 | HTH-type transcriptional regulator | - |
P8T41_RS05050 (P8T41_05050) | 1015711..1015923 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
P8T41_RS05055 (P8T41_05055) | 1016022..1017641 | - | 1620 | WP_032415799.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
P8T41_RS05060 (P8T41_05060) | 1017943..1018095 | - | 153 | WP_002922102.1 | type I toxin-antitoxin system toxin HokA | - |
P8T41_RS05065 (P8T41_05065) | 1018439..1018924 | - | 486 | WP_032415800.1 | GNAT family N-acetyltransferase | Toxin |
P8T41_RS05070 (P8T41_05070) | 1018912..1019178 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
P8T41_RS05075 (P8T41_05075) | 1019311..1019739 | - | 429 | WP_004901287.1 | GFA family protein | - |
P8T41_RS05085 (P8T41_05085) | 1021606..1023675 | - | 2070 | WP_002922127.1 | glycine--tRNA ligase subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1019940..1020665 | 725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17624.46 Da Isoelectric Point: 10.1428
>T275765 WP_032415800.1 NZ_CP121135:c1018924-1018439 [Klebsiella pneumoniae]
VGRITAPEPLCSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGRITAPEPLCSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|