Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 13538..14274 Replicon plasmid pESBL-PH-45
Accession NZ_CP121134
Organism Klebsiella pneumoniae strain UHD-45_PH

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag P8T31_RS25870 Protein ID WP_003026803.1
Coordinates 13538..14020 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag P8T31_RS25875 Protein ID WP_003026799.1
Coordinates 14008..14274 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T31_RS25845 (P8T31_25845) 8613..9101 + 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -
P8T31_RS25850 (P8T31_25850) 9088..10050 + 963 WP_004152113.1 zinc metalloprotease HtpX -
P8T31_RS25855 (P8T31_25855) 10227..11392 + 1166 Protein_14 IS3 family transposase -
P8T31_RS25860 (P8T31_25860) 11540..11935 - 396 WP_004143398.1 helix-turn-helix domain-containing protein -
P8T31_RS25865 (P8T31_25865) 11984..13330 - 1347 WP_077253535.1 ISNCY family transposase -
P8T31_RS25870 (P8T31_25870) 13538..14020 - 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
P8T31_RS25875 (P8T31_25875) 14008..14274 - 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
P8T31_RS25880 (P8T31_25880) 14450..14704 - 255 WP_004152108.1 hypothetical protein -
P8T31_RS25885 (P8T31_25885) 14780..15037 - 258 WP_004152107.1 hypothetical protein -
P8T31_RS25890 (P8T31_25890) 15086..15289 - 204 WP_004152106.1 HHA domain-containing protein -
P8T31_RS25895 (P8T31_25895) 15323..15691 - 369 WP_004152105.1 hypothetical protein -
P8T31_RS25900 (P8T31_25900) 15735..16229 - 495 WP_004152104.1 DNA-binding protein -
P8T31_RS25905 (P8T31_25905) 16260..16835 - 576 WP_004152103.1 hypothetical protein -
P8T31_RS25910 (P8T31_25910) 16823..17092 - 270 WP_004152102.1 hypothetical protein -
P8T31_RS25915 (P8T31_25915) 17450..17800 + 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
P8T31_RS25920 (P8T31_25920) 17850..18212 + 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA14 / qnrB1 / tet(A) / aac(6')-Ib-cr / blaOXA-1 / aac(3)-IIa / blaCTX-M-15 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 - 1..247179 247179


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T275761 WP_003026803.1 NZ_CP121134:c14020-13538 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT275761 WP_003026799.1 NZ_CP121134:c14274-14008 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References