Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 5069075..5069814 | Replicon | chromosome |
| Accession | NZ_CP121133 | ||
| Organism | Klebsiella pneumoniae strain UHD-45_PH | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | P8T31_RS24570 | Protein ID | WP_032415800.1 |
| Coordinates | 5069075..5069560 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | P8T31_RS24575 | Protein ID | WP_003026799.1 |
| Coordinates | 5069548..5069814 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8T31_RS24545 (P8T31_24545) | 5064203..5065558 | + | 1356 | WP_032415797.1 | aromatic acid/H+ symport family MFS transporter | - |
| P8T31_RS24550 (P8T31_24550) | 5065804..5066094 | + | 291 | WP_002921931.1 | HTH-type transcriptional regulator | - |
| P8T31_RS24555 (P8T31_24555) | 5066347..5066559 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| P8T31_RS24560 (P8T31_24560) | 5066658..5068277 | - | 1620 | WP_032415799.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| P8T31_RS24565 (P8T31_24565) | 5068579..5068731 | - | 153 | WP_002922102.1 | type I toxin-antitoxin system toxin HokA | - |
| P8T31_RS24570 (P8T31_24570) | 5069075..5069560 | - | 486 | WP_032415800.1 | GNAT family N-acetyltransferase | Toxin |
| P8T31_RS24575 (P8T31_24575) | 5069548..5069814 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| P8T31_RS24580 (P8T31_24580) | 5069947..5070375 | - | 429 | WP_004901287.1 | GFA family protein | - |
| P8T31_RS24590 (P8T31_24590) | 5072242..5074311 | - | 2070 | WP_002922127.1 | glycine--tRNA ligase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 5070576..5071301 | 725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17624.46 Da Isoelectric Point: 10.1428
>T275760 WP_032415800.1 NZ_CP121133:c5069560-5069075 [Klebsiella pneumoniae]
VGRITAPEPLCSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGRITAPEPLCSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|