Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4472159..4472816 | Replicon | chromosome |
Accession | NZ_CP121133 | ||
Organism | Klebsiella pneumoniae strain UHD-45_PH |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | P8T31_RS21590 | Protein ID | WP_002916310.1 |
Coordinates | 4472159..4472569 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | P8T31_RS21595 | Protein ID | WP_002916312.1 |
Coordinates | 4472550..4472816 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8T31_RS21570 (P8T31_21570) | 4468159..4469892 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
P8T31_RS21575 (P8T31_21575) | 4469898..4470611 | - | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P8T31_RS21580 (P8T31_21580) | 4470634..4471530 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
P8T31_RS21585 (P8T31_21585) | 4471631..4472152 | + | 522 | WP_004144730.1 | flavodoxin FldB | - |
P8T31_RS21590 (P8T31_21590) | 4472159..4472569 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
P8T31_RS21595 (P8T31_21595) | 4472550..4472816 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
P8T31_RS21600 (P8T31_21600) | 4473062..4474045 | + | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
P8T31_RS21605 (P8T31_21605) | 4474196..4474855 | - | 660 | WP_002916317.1 | hemolysin III family protein | - |
P8T31_RS21610 (P8T31_21610) | 4475019..4475330 | - | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
P8T31_RS21615 (P8T31_21615) | 4475380..4476108 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
P8T31_RS21620 (P8T31_21620) | 4476227..4477660 | + | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T275757 WP_002916310.1 NZ_CP121133:c4472569-4472159 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |