Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1235471..1236090 Replicon chromosome
Accession NZ_CP121133
Organism Klebsiella pneumoniae strain UHD-45_PH

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag P8T31_RS05855 Protein ID WP_002892050.1
Coordinates 1235471..1235689 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag P8T31_RS05860 Protein ID WP_002892066.1
Coordinates 1235716..1236090 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T31_RS05820 (P8T31_05820) 1231518..1231781 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
P8T31_RS05825 (P8T31_05825) 1231781..1231921 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
P8T31_RS05830 (P8T31_05830) 1231918..1232616 - 699 WP_032414604.1 GNAT family protein -
P8T31_RS05835 (P8T31_05835) 1232717..1234168 + 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
P8T31_RS05840 (P8T31_05840) 1234143..1234613 - 471 WP_002892026.1 YlaC family protein -
P8T31_RS05845 (P8T31_05845) 1234634..1234774 + 141 WP_004147370.1 hypothetical protein -
P8T31_RS05850 (P8T31_05850) 1234746..1235312 - 567 WP_002892030.1 maltose O-acetyltransferase -
P8T31_RS05855 (P8T31_05855) 1235471..1235689 - 219 WP_002892050.1 HHA domain-containing protein Toxin
P8T31_RS05860 (P8T31_05860) 1235716..1236090 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
P8T31_RS05865 (P8T31_05865) 1236576..1239722 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
P8T31_RS05870 (P8T31_05870) 1239745..1240938 - 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T275751 WP_002892050.1 NZ_CP121133:c1235689-1235471 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT275751 WP_002892066.1 NZ_CP121133:c1236090-1235716 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References