Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 509296..509812 | Replicon | chromosome |
| Accession | NZ_CP121133 | ||
| Organism | Klebsiella pneumoniae strain UHD-45_PH | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | P8T31_RS02440 | Protein ID | WP_004178374.1 |
| Coordinates | 509528..509812 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | P8T31_RS02435 | Protein ID | WP_002886901.1 |
| Coordinates | 509296..509538 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8T31_RS02420 (P8T31_02420) | 505324..506064 | + | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
| P8T31_RS02425 (P8T31_02425) | 506131..507285 | + | 1155 | WP_032415878.1 | lactonase family protein | - |
| P8T31_RS02430 (P8T31_02430) | 507308..509218 | + | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
| P8T31_RS02435 (P8T31_02435) | 509296..509538 | + | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| P8T31_RS02440 (P8T31_02440) | 509528..509812 | + | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P8T31_RS02445 (P8T31_02445) | 509816..510280 | - | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| P8T31_RS02450 (P8T31_02450) | 510609..512747 | - | 2139 | WP_032415880.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| P8T31_RS02455 (P8T31_02455) | 513104..513847 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| P8T31_RS02460 (P8T31_02460) | 513850..514023 | - | 174 | WP_004222159.1 | hypothetical protein | - |
| P8T31_RS02465 (P8T31_02465) | 514108..514416 | + | 309 | WP_002886907.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T275749 WP_004178374.1 NZ_CP121133:509528-509812 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |