Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 90032..90768 Replicon plasmid pESBL-PH-50
Accession NZ_CP121132
Organism Klebsiella pneumoniae strain UHD-50_PH

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag P8T45_RS26210 Protein ID WP_003026803.1
Coordinates 90032..90514 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag P8T45_RS26215 Protein ID WP_003026799.1
Coordinates 90502..90768 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T45_RS26185 (P8T45_26190) 85107..85595 + 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -
P8T45_RS26190 (P8T45_26195) 85582..86544 + 963 WP_004152113.1 zinc metalloprotease HtpX -
P8T45_RS26195 (P8T45_26200) 86721..87886 + 1166 Protein_86 IS3 family transposase -
P8T45_RS26200 (P8T45_26205) 88034..88429 - 396 WP_004143398.1 helix-turn-helix domain-containing protein -
P8T45_RS26205 (P8T45_26210) 88478..89824 - 1347 WP_077253535.1 ISNCY family transposase -
P8T45_RS26210 (P8T45_26215) 90032..90514 - 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
P8T45_RS26215 (P8T45_26220) 90502..90768 - 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
P8T45_RS26220 (P8T45_26225) 90944..91198 - 255 WP_004152108.1 hypothetical protein -
P8T45_RS26225 (P8T45_26230) 91274..91531 - 258 WP_004152107.1 hypothetical protein -
P8T45_RS26230 (P8T45_26235) 91580..91783 - 204 WP_004152106.1 HHA domain-containing protein -
P8T45_RS26235 (P8T45_26240) 91817..92185 - 369 WP_004152105.1 hypothetical protein -
P8T45_RS26240 (P8T45_26245) 92229..92723 - 495 WP_004152104.1 DNA-binding protein -
P8T45_RS26245 (P8T45_26250) 92754..93329 - 576 WP_004152103.1 hypothetical protein -
P8T45_RS26250 (P8T45_26255) 93317..93586 - 270 WP_004152102.1 hypothetical protein -
P8T45_RS26255 (P8T45_26260) 93944..94294 + 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
P8T45_RS26260 (P8T45_26265) 94344..94706 + 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-15 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 / dfrA14 / qnrB1 / tet(A) / aac(6')-Ib-cr / blaOXA-1 / aac(3)-IIa - 1..247177 247177


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T275746 WP_003026803.1 NZ_CP121132:c90514-90032 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT275746 WP_003026799.1 NZ_CP121132:c90768-90502 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References