Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 3743955..3744694 | Replicon | chromosome |
| Accession | NZ_CP121131 | ||
| Organism | Klebsiella pneumoniae strain UHD-50_PH | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | P8T45_RS18135 | Protein ID | WP_032415800.1 |
| Coordinates | 3744209..3744694 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | P8T45_RS18130 | Protein ID | WP_003026799.1 |
| Coordinates | 3743955..3744221 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8T45_RS18115 (P8T45_18120) | 3739458..3741527 | + | 2070 | WP_002922127.1 | glycine--tRNA ligase subunit beta | - |
| P8T45_RS18120 (P8T45_18125) | 3741824..3743193 | + | 1370 | WP_087830479.1 | IS3 family transposase | - |
| P8T45_RS18125 (P8T45_18130) | 3743394..3743822 | + | 429 | WP_004901287.1 | GFA family protein | - |
| P8T45_RS18130 (P8T45_18135) | 3743955..3744221 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| P8T45_RS18135 (P8T45_18140) | 3744209..3744694 | + | 486 | WP_032415800.1 | GNAT family N-acetyltransferase | Toxin |
| P8T45_RS18140 (P8T45_18145) | 3745038..3745190 | + | 153 | WP_002922102.1 | type I toxin-antitoxin system toxin HokA | - |
| P8T45_RS18145 (P8T45_18150) | 3745492..3747111 | + | 1620 | WP_032415799.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| P8T45_RS18150 (P8T45_18155) | 3747210..3747422 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| P8T45_RS18155 (P8T45_18160) | 3747675..3747965 | - | 291 | WP_002921931.1 | HTH-type transcriptional regulator | - |
| P8T45_RS18160 (P8T45_18165) | 3748211..3749566 | - | 1356 | WP_032415797.1 | aromatic acid/H+ symport family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3742468..3743193 | 725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17624.46 Da Isoelectric Point: 10.1428
>T275742 WP_032415800.1 NZ_CP121131:3744209-3744694 [Klebsiella pneumoniae]
VGRITAPEPLCSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGRITAPEPLCSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|