Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2984317..2984833 | Replicon | chromosome |
| Accession | NZ_CP121131 | ||
| Organism | Klebsiella pneumoniae strain UHD-50_PH | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | P8T45_RS14485 | Protein ID | WP_004178374.1 |
| Coordinates | 2984317..2984601 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | P8T45_RS14490 | Protein ID | WP_002886901.1 |
| Coordinates | 2984591..2984833 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8T45_RS14460 (P8T45_14465) | 2979713..2979976 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
| P8T45_RS14465 (P8T45_14470) | 2980106..2980279 | + | 174 | WP_004222159.1 | hypothetical protein | - |
| P8T45_RS14470 (P8T45_14475) | 2980282..2981025 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| P8T45_RS14475 (P8T45_14480) | 2981382..2983520 | + | 2139 | WP_032415880.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| P8T45_RS14480 (P8T45_14485) | 2983849..2984313 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| P8T45_RS14485 (P8T45_14490) | 2984317..2984601 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P8T45_RS14490 (P8T45_14495) | 2984591..2984833 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| P8T45_RS14495 (P8T45_14500) | 2984911..2986821 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
| P8T45_RS14500 (P8T45_14505) | 2986844..2987998 | - | 1155 | WP_032415878.1 | lactonase family protein | - |
| P8T45_RS14505 (P8T45_14510) | 2988065..2988805 | - | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T275739 WP_004178374.1 NZ_CP121131:c2984601-2984317 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |