Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2257966..2258585 Replicon chromosome
Accession NZ_CP121131
Organism Klebsiella pneumoniae strain UHD-50_PH

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag P8T45_RS11065 Protein ID WP_002892050.1
Coordinates 2258367..2258585 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag P8T45_RS11060 Protein ID WP_002892066.1
Coordinates 2257966..2258340 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T45_RS11050 (P8T45_11055) 2253118..2254311 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
P8T45_RS11055 (P8T45_11060) 2254334..2257480 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
P8T45_RS11060 (P8T45_11065) 2257966..2258340 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
P8T45_RS11065 (P8T45_11070) 2258367..2258585 + 219 WP_002892050.1 HHA domain-containing protein Toxin
P8T45_RS11070 (P8T45_11075) 2258744..2259310 + 567 WP_002892030.1 maltose O-acetyltransferase -
P8T45_RS11075 (P8T45_11080) 2259282..2259422 - 141 WP_004147370.1 hypothetical protein -
P8T45_RS11080 (P8T45_11085) 2259443..2259913 + 471 WP_002892026.1 YlaC family protein -
P8T45_RS11085 (P8T45_11090) 2259888..2261339 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
P8T45_RS11090 (P8T45_11095) 2261440..2262138 + 699 WP_032414604.1 GNAT family protein -
P8T45_RS11095 (P8T45_11100) 2262135..2262275 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
P8T45_RS11100 (P8T45_11105) 2262275..2262538 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T275737 WP_002892050.1 NZ_CP121131:2258367-2258585 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT275737 WP_002892066.1 NZ_CP121131:2257966-2258340 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References