Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 113776..114512 Replicon plasmid pESBL-PH-49
Accession NZ_CP121130
Organism Klebsiella pneumoniae strain UHD-49_PH

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag P8T37_RS26350 Protein ID WP_003026803.1
Coordinates 113776..114258 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag P8T37_RS26355 Protein ID WP_003026799.1
Coordinates 114246..114512 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T37_RS26325 (P8T37_26325) 108851..109339 + 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -
P8T37_RS26330 (P8T37_26330) 109326..110288 + 963 WP_004152113.1 zinc metalloprotease HtpX -
P8T37_RS26335 (P8T37_26335) 110465..111630 + 1166 Protein_113 IS3 family transposase -
P8T37_RS26340 (P8T37_26340) 111778..112173 - 396 WP_004143398.1 helix-turn-helix domain-containing protein -
P8T37_RS26345 (P8T37_26345) 112222..113568 - 1347 WP_077253535.1 ISNCY family transposase -
P8T37_RS26350 (P8T37_26350) 113776..114258 - 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
P8T37_RS26355 (P8T37_26355) 114246..114512 - 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
P8T37_RS26360 (P8T37_26360) 114688..114942 - 255 WP_004152108.1 hypothetical protein -
P8T37_RS26365 (P8T37_26365) 115018..115275 - 258 WP_004152107.1 hypothetical protein -
P8T37_RS26370 (P8T37_26370) 115324..115527 - 204 WP_004152106.1 HHA domain-containing protein -
P8T37_RS26375 (P8T37_26375) 115561..115929 - 369 WP_004152105.1 hypothetical protein -
P8T37_RS26380 (P8T37_26380) 115973..116467 - 495 WP_004152104.1 DNA-binding protein -
P8T37_RS26385 (P8T37_26385) 116498..117073 - 576 WP_004152103.1 hypothetical protein -
P8T37_RS26390 (P8T37_26390) 117061..117330 - 270 WP_004152102.1 hypothetical protein -
P8T37_RS26395 (P8T37_26395) 117688..118038 + 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
P8T37_RS26400 (P8T37_26400) 118088..118450 + 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA14 / qnrB1 / tet(A) / aac(6')-Ib-cr / blaOXA-1 / aac(3)-IIa / blaCTX-M-15 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 - 1..247178 247178


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T275731 WP_003026803.1 NZ_CP121130:c114258-113776 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT275731 WP_003026799.1 NZ_CP121130:c114512-114246 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References