Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4961423..4962162 | Replicon | chromosome |
| Accession | NZ_CP121129 | ||
| Organism | Klebsiella pneumoniae strain UHD-49_PH | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | P8T37_RS24070 | Protein ID | WP_032415800.1 |
| Coordinates | 4961423..4961908 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | P8T37_RS24075 | Protein ID | WP_003026799.1 |
| Coordinates | 4961896..4962162 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8T37_RS24045 (P8T37_24045) | 4956551..4957906 | + | 1356 | WP_032415797.1 | aromatic acid/H+ symport family MFS transporter | - |
| P8T37_RS24050 (P8T37_24050) | 4958152..4958442 | + | 291 | WP_002921931.1 | HTH-type transcriptional regulator | - |
| P8T37_RS24055 (P8T37_24055) | 4958695..4958907 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| P8T37_RS24060 (P8T37_24060) | 4959006..4960625 | - | 1620 | WP_032415799.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| P8T37_RS24065 (P8T37_24065) | 4960927..4961079 | - | 153 | WP_002922102.1 | type I toxin-antitoxin system toxin HokA | - |
| P8T37_RS24070 (P8T37_24070) | 4961423..4961908 | - | 486 | WP_032415800.1 | GNAT family N-acetyltransferase | Toxin |
| P8T37_RS24075 (P8T37_24075) | 4961896..4962162 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| P8T37_RS24080 (P8T37_24080) | 4962295..4962723 | - | 429 | WP_004901287.1 | GFA family protein | - |
| P8T37_RS24090 (P8T37_24090) | 4964590..4966659 | - | 2070 | WP_002922127.1 | glycine--tRNA ligase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4962924..4963649 | 725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17624.46 Da Isoelectric Point: 10.1428
>T275729 WP_032415800.1 NZ_CP121129:c4961908-4961423 [Klebsiella pneumoniae]
VGRITAPEPLCSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGRITAPEPLCSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|