Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4364507..4365164 | Replicon | chromosome |
Accession | NZ_CP121129 | ||
Organism | Klebsiella pneumoniae strain UHD-49_PH |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | P8T37_RS21090 | Protein ID | WP_002916310.1 |
Coordinates | 4364507..4364917 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | P8T37_RS21095 | Protein ID | WP_002916312.1 |
Coordinates | 4364898..4365164 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8T37_RS21070 (P8T37_21070) | 4360507..4362240 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
P8T37_RS21075 (P8T37_21075) | 4362246..4362959 | - | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P8T37_RS21080 (P8T37_21080) | 4362982..4363878 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
P8T37_RS21085 (P8T37_21085) | 4363979..4364500 | + | 522 | WP_004144730.1 | flavodoxin FldB | - |
P8T37_RS21090 (P8T37_21090) | 4364507..4364917 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
P8T37_RS21095 (P8T37_21095) | 4364898..4365164 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
P8T37_RS21100 (P8T37_21100) | 4365410..4366393 | + | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
P8T37_RS21105 (P8T37_21105) | 4366544..4367203 | - | 660 | WP_002916317.1 | hemolysin III family protein | - |
P8T37_RS21110 (P8T37_21110) | 4367367..4367678 | - | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
P8T37_RS21115 (P8T37_21115) | 4367728..4368456 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
P8T37_RS21120 (P8T37_21120) | 4368575..4370008 | + | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T275726 WP_002916310.1 NZ_CP121129:c4364917-4364507 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |