Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1130879..1131498 Replicon chromosome
Accession NZ_CP121129
Organism Klebsiella pneumoniae strain UHD-49_PH

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag P8T37_RS05370 Protein ID WP_002892050.1
Coordinates 1130879..1131097 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag P8T37_RS05375 Protein ID WP_002892066.1
Coordinates 1131124..1131498 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T37_RS05335 (P8T37_05335) 1126926..1127189 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
P8T37_RS05340 (P8T37_05340) 1127189..1127329 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
P8T37_RS05345 (P8T37_05345) 1127326..1128024 - 699 WP_032414604.1 GNAT family protein -
P8T37_RS05350 (P8T37_05350) 1128125..1129576 + 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
P8T37_RS05355 (P8T37_05355) 1129551..1130021 - 471 WP_002892026.1 YlaC family protein -
P8T37_RS05360 (P8T37_05360) 1130042..1130182 + 141 WP_004147370.1 hypothetical protein -
P8T37_RS05365 (P8T37_05365) 1130154..1130720 - 567 WP_002892030.1 maltose O-acetyltransferase -
P8T37_RS05370 (P8T37_05370) 1130879..1131097 - 219 WP_002892050.1 HHA domain-containing protein Toxin
P8T37_RS05375 (P8T37_05375) 1131124..1131498 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
P8T37_RS05380 (P8T37_05380) 1131984..1135130 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
P8T37_RS05385 (P8T37_05385) 1135153..1136346 - 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T275720 WP_002892050.1 NZ_CP121129:c1131097-1130879 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT275720 WP_002892066.1 NZ_CP121129:c1131498-1131124 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References