Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 518925..519735 | Replicon | chromosome |
Accession | NZ_CP121129 | ||
Organism | Klebsiella pneumoniae strain UHD-49_PH |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A060VJ83 |
Locus tag | P8T37_RS02430 | Protein ID | WP_004178461.1 |
Coordinates | 519202..519735 (+) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | P8T37_RS02425 | Protein ID | WP_002887278.1 |
Coordinates | 518925..519191 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8T37_RS02405 (P8T37_02405) | 514796..515140 | - | 345 | WP_116288284.1 | cation efflux system protein CusF | - |
P8T37_RS02410 (P8T37_02410) | 515158..516543 | - | 1386 | WP_026005908.1 | efflux transporter outer membrane subunit | - |
P8T37_RS02415 (P8T37_02415) | 516716..517399 | + | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
P8T37_RS02420 (P8T37_02420) | 517389..518822 | + | 1434 | WP_032415907.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
P8T37_RS02425 (P8T37_02425) | 518925..519191 | + | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
P8T37_RS02430 (P8T37_02430) | 519202..519735 | + | 534 | WP_004178461.1 | type II toxin-antitoxin system toxin KacT | Toxin |
P8T37_RS02435 (P8T37_02435) | 519783..520904 | - | 1122 | WP_012737335.1 | cupin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19810.65 Da Isoelectric Point: 5.2614
>T275719 WP_004178461.1 NZ_CP121129:519202-519735 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VJ83 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |