Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 404630..405146 | Replicon | chromosome |
| Accession | NZ_CP121129 | ||
| Organism | Klebsiella pneumoniae strain UHD-49_PH | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | P8T37_RS01955 | Protein ID | WP_004178374.1 |
| Coordinates | 404862..405146 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | P8T37_RS01950 | Protein ID | WP_002886901.1 |
| Coordinates | 404630..404872 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8T37_RS01935 (P8T37_01935) | 400658..401398 | + | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
| P8T37_RS01940 (P8T37_01940) | 401465..402619 | + | 1155 | WP_032415878.1 | lactonase family protein | - |
| P8T37_RS01945 (P8T37_01945) | 402642..404552 | + | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
| P8T37_RS01950 (P8T37_01950) | 404630..404872 | + | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| P8T37_RS01955 (P8T37_01955) | 404862..405146 | + | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P8T37_RS01960 (P8T37_01960) | 405150..405614 | - | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| P8T37_RS01965 (P8T37_01965) | 405943..408081 | - | 2139 | WP_032415880.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| P8T37_RS01970 (P8T37_01970) | 408438..409181 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| P8T37_RS01975 (P8T37_01975) | 409184..409357 | - | 174 | WP_004222159.1 | hypothetical protein | - |
| P8T37_RS01980 (P8T37_01980) | 409442..409750 | + | 309 | WP_002886907.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T275718 WP_004178374.1 NZ_CP121129:404862-405146 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |