Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 195290..196026 Replicon plasmid pESBL-PH-53
Accession NZ_CP121128
Organism Klebsiella pneumoniae strain UHD-53_PH

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag P8T39_RS26800 Protein ID WP_003026803.1
Coordinates 195544..196026 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag P8T39_RS26795 Protein ID WP_003026799.1
Coordinates 195290..195556 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T39_RS26750 (P8T39_26745) 191352..191714 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
P8T39_RS26755 (P8T39_26750) 191764..192114 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
P8T39_RS26760 (P8T39_26755) 192472..192741 + 270 WP_004152102.1 hypothetical protein -
P8T39_RS26765 (P8T39_26760) 192729..193304 + 576 WP_004152103.1 hypothetical protein -
P8T39_RS26770 (P8T39_26765) 193335..193829 + 495 WP_004152104.1 DNA-binding protein -
P8T39_RS26775 (P8T39_26770) 193873..194241 + 369 WP_004152105.1 hypothetical protein -
P8T39_RS26780 (P8T39_26775) 194275..194478 + 204 WP_004152106.1 HHA domain-containing protein -
P8T39_RS26785 (P8T39_26780) 194527..194784 + 258 WP_004152107.1 hypothetical protein -
P8T39_RS26790 (P8T39_26785) 194860..195114 + 255 WP_004152108.1 hypothetical protein -
P8T39_RS26795 (P8T39_26790) 195290..195556 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
P8T39_RS26800 (P8T39_26795) 195544..196026 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
P8T39_RS26805 (P8T39_26800) 196234..197580 + 1347 WP_077253535.1 ISNCY family transposase -
P8T39_RS26810 (P8T39_26805) 197629..198024 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
P8T39_RS26815 (P8T39_26810) 198172..199337 - 1166 Protein_209 IS3 family transposase -
P8T39_RS26820 (P8T39_26815) 199514..200476 - 963 WP_004152113.1 zinc metalloprotease HtpX -
P8T39_RS26825 (P8T39_26820) 200463..200951 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / tet(A) / qnrB1 / dfrA14 - 1..247179 247179


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T275716 WP_003026803.1 NZ_CP121128:195544-196026 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT275716 WP_003026799.1 NZ_CP121128:195290-195556 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References