Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3659087..3659706 Replicon chromosome
Accession NZ_CP121127
Organism Klebsiella pneumoniae strain UHD-53_PH

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag P8T39_RS17970 Protein ID WP_002892050.1
Coordinates 3659488..3659706 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag P8T39_RS17965 Protein ID WP_002892066.1
Coordinates 3659087..3659461 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T39_RS17955 (P8T39_17955) 3654239..3655432 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
P8T39_RS17960 (P8T39_17960) 3655455..3658601 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
P8T39_RS17965 (P8T39_17965) 3659087..3659461 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
P8T39_RS17970 (P8T39_17970) 3659488..3659706 + 219 WP_002892050.1 HHA domain-containing protein Toxin
P8T39_RS17975 (P8T39_17975) 3659865..3660431 + 567 WP_002892030.1 maltose O-acetyltransferase -
P8T39_RS17980 (P8T39_17980) 3660403..3660543 - 141 WP_004147370.1 hypothetical protein -
P8T39_RS17985 (P8T39_17985) 3660564..3661034 + 471 WP_002892026.1 YlaC family protein -
P8T39_RS17990 (P8T39_17990) 3661009..3662460 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
P8T39_RS17995 (P8T39_17995) 3662561..3663259 + 699 WP_032414604.1 GNAT family protein -
P8T39_RS18000 (P8T39_18000) 3663256..3663396 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
P8T39_RS18005 (P8T39_18005) 3663396..3663659 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T275708 WP_002892050.1 NZ_CP121127:3659488-3659706 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT275708 WP_002892066.1 NZ_CP121127:3659087-3659461 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References