Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1348149..1348790 | Replicon | chromosome |
| Accession | NZ_CP121119 | ||
| Organism | Halomonas sp. M1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | P8S54_RS06075 | Protein ID | WP_281443645.1 |
| Coordinates | 1348149..1348331 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | P8S54_RS06080 | Protein ID | WP_281443646.1 |
| Coordinates | 1348371..1348790 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8S54_RS06045 (P8S55_06030) | 1343352..1344233 | + | 882 | WP_281443643.1 | NAD(P)-dependent oxidoreductase | - |
| P8S54_RS06060 (P8S55_06045) | 1344908..1346386 | - | 1479 | WP_281443644.1 | glutamate--tRNA ligase | - |
| P8S54_RS06065 (P8S55_06050) | 1346688..1347212 | + | 525 | WP_009098845.1 | helix-turn-helix domain-containing protein | - |
| P8S54_RS06070 (P8S55_06055) | 1347233..1347814 | - | 582 | WP_009098846.1 | hypothetical protein | - |
| P8S54_RS06075 (P8S55_06060) | 1348149..1348331 | + | 183 | WP_281443645.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| P8S54_RS06080 (P8S55_06065) | 1348371..1348790 | + | 420 | WP_281443646.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| P8S54_RS06085 (P8S55_06070) | 1348910..1349059 | + | 150 | WP_281443647.1 | hypothetical protein | - |
| P8S54_RS06090 (P8S55_06075) | 1349156..1349821 | - | 666 | WP_281443648.1 | hypothetical protein | - |
| P8S54_RS06095 (P8S55_06080) | 1349811..1350215 | - | 405 | WP_281443649.1 | hypothetical protein | - |
| P8S54_RS06100 (P8S55_06085) | 1350220..1351332 | - | 1113 | WP_281443650.1 | hypothetical protein | - |
| P8S54_RS06105 (P8S55_06090) | 1351887..1352918 | + | 1032 | WP_281443651.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6710.81 Da Isoelectric Point: 11.7334
>T275700 WP_281443645.1 NZ_CP121119:1348149-1348331 [Halomonas sp. M1]
VNSRALIKELEQDGWKLARINGSHHHFRHPNKPGTVTVPHPKKDLKTGLVRGIRKSAGLL
VNSRALIKELEQDGWKLARINGSHHHFRHPNKPGTVTVPHPKKDLKTGLVRGIRKSAGLL
Download Length: 183 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15437.44 Da Isoelectric Point: 4.3241
>AT275700 WP_281443646.1 NZ_CP121119:1348371-1348790 [Halomonas sp. M1]
MLFPIAIERGDEQHAYGVVVPDLNGCFSAGDTFEEALANVKEAIEGWLEVAVEYGDPIPEAQTIEQHMENPDFEGWIWAV
VDIDLTPYLGKSHKINVTLPDLLVKQIDDYVASHPGDKTRSGFLSRVAMAELARARKRA
MLFPIAIERGDEQHAYGVVVPDLNGCFSAGDTFEEALANVKEAIEGWLEVAVEYGDPIPEAQTIEQHMENPDFEGWIWAV
VDIDLTPYLGKSHKINVTLPDLLVKQIDDYVASHPGDKTRSGFLSRVAMAELARARKRA
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|