Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 738047..738642 | Replicon | plasmid unnamed |
| Accession | NZ_CP121109 | ||
| Organism | Pantoea sp. X85 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | P6287_RS22980 | Protein ID | WP_277975140.1 |
| Coordinates | 738047..738424 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | - |
| Locus tag | P6287_RS22985 | Protein ID | WP_110867236.1 |
| Coordinates | 738421..738642 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6287_RS22960 (P6287_22960) | 734647..735960 | + | 1314 | WP_277975139.1 | cytochrome c | - |
| P6287_RS22965 (P6287_22965) | 736071..736535 | - | 465 | WP_210080080.1 | heme-degrading domain-containing protein | - |
| P6287_RS22970 (P6287_22970) | 736618..736968 | - | 351 | WP_192414734.1 | cupin domain-containing protein | - |
| P6287_RS22975 (P6287_22975) | 737114..738037 | + | 924 | WP_192414732.1 | glutaminase B | - |
| P6287_RS22980 (P6287_22980) | 738047..738424 | - | 378 | WP_277975140.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| P6287_RS22985 (P6287_22985) | 738421..738642 | - | 222 | WP_110867236.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| P6287_RS22990 (P6287_22990) | 738889..739305 | + | 417 | WP_137387179.1 | DUF2946 domain-containing protein | - |
| P6287_RS22995 (P6287_22995) | 739378..741114 | + | 1737 | WP_277975141.1 | DUF2534 family protein | - |
| P6287_RS23000 (P6287_23000) | 741195..742211 | - | 1017 | WP_008108001.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| P6287_RS23005 (P6287_23005) | 742334..742603 | - | 270 | WP_101761136.1 | hypothetical protein | - |
| P6287_RS23010 (P6287_23010) | 742884..743444 | + | 561 | WP_217547695.1 | thioredoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | hcp/tssD | 1..771939 | 771939 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13942.06 Da Isoelectric Point: 6.9892
>T275699 WP_277975140.1 NZ_CP121109:c738424-738047 [Pantoea sp. X85]
MIHVSAEEVIALHDYLLKRYAGVAGMPDPGRAEAIVARVINREYYEGIQDIFELAATYWVAISRGHIFADANKRTSLNVT
MLFLKRNGIRVHDRPELVELTVMAATGEAGVPFLANQLRAFFGSH
MIHVSAEEVIALHDYLLKRYAGVAGMPDPGRAEAIVARVINREYYEGIQDIFELAATYWVAISRGHIFADANKRTSLNVT
MLFLKRNGIRVHDRPELVELTVMAATGEAGVPFLANQLRAFFGSH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|