Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 725226..725776 | Replicon | plasmid unnamed |
Accession | NZ_CP121109 | ||
Organism | Pantoea sp. X85 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | P6287_RS22915 | Protein ID | WP_137387189.1 |
Coordinates | 725468..725776 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | P6287_RS22910 | Protein ID | WP_137387190.1 |
Coordinates | 725226..725465 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6287_RS22890 (P6287_22890) | 720999..722165 | + | 1167 | WP_277975133.1 | lycopene beta-cyclase CrtY | - |
P6287_RS22895 (P6287_22895) | 722162..723643 | + | 1482 | WP_277975134.1 | phytoene desaturase | - |
P6287_RS22900 (P6287_22900) | 723640..724569 | + | 930 | WP_217547671.1 | phytoene/squalene synthase family protein | - |
P6287_RS22905 (P6287_22905) | 724508..725041 | - | 534 | WP_101761117.1 | sterol desaturase family protein | - |
P6287_RS22910 (P6287_22910) | 725226..725465 | + | 240 | WP_137387190.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
P6287_RS22915 (P6287_22915) | 725468..725776 | + | 309 | WP_137387189.1 | CcdB family protein | Toxin |
P6287_RS22920 (P6287_22920) | 725908..727098 | + | 1191 | WP_277975135.1 | MFS transporter | - |
P6287_RS22925 (P6287_22925) | 727091..727435 | - | 345 | WP_192413440.1 | helix-turn-helix transcriptional regulator | - |
P6287_RS22930 (P6287_22930) | 727532..728473 | - | 942 | WP_192413442.1 | sugar phosphate isomerase/epimerase | - |
P6287_RS22935 (P6287_22935) | 728482..729660 | - | 1179 | WP_277975136.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | hcp/tssD | 1..771939 | 771939 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 12035.88 Da Isoelectric Point: 5.8576
>T275698 WP_137387189.1 NZ_CP121109:725468-725776 [Pantoea sp. X85]
MQYFIYRNTNRNSEYPYLVDVQSEIIGELASRIVIPLYPLNQFKKKQVERLNPVIKVEGEEFLVMTHEMASVRVSLLGDQ
VMDARVYRQRIKDSVDFVFDGF
MQYFIYRNTNRNSEYPYLVDVQSEIIGELASRIVIPLYPLNQFKKKQVERLNPVIKVEGEEFLVMTHEMASVRVSLLGDQ
VMDARVYRQRIKDSVDFVFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|