Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH |
Location | 534293..534995 | Replicon | plasmid unnamed |
Accession | NZ_CP121109 | ||
Organism | Pantoea sp. X85 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | P6287_RS22050 | Protein ID | WP_192413132.1 |
Coordinates | 534612..534995 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | P6287_RS22045 | Protein ID | WP_137387307.1 |
Coordinates | 534293..534619 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6287_RS22025 (P6287_22025) | 530007..530894 | + | 888 | WP_277975035.1 | aromatic amino acid DMT transporter YddG | - |
P6287_RS22030 (P6287_22030) | 531053..532255 | - | 1203 | WP_277975036.1 | FAD-dependent oxidoreductase | - |
P6287_RS22035 (P6287_22035) | 532310..533245 | - | 936 | WP_277975037.1 | AraC family transcriptional regulator | - |
P6287_RS22040 (P6287_22040) | 533357..534190 | + | 834 | WP_277975038.1 | oxidoreductase | - |
P6287_RS22045 (P6287_22045) | 534293..534619 | - | 327 | WP_137387307.1 | helix-turn-helix domain-containing protein | Antitoxin |
P6287_RS22050 (P6287_22050) | 534612..534995 | - | 384 | WP_192413132.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P6287_RS22055 (P6287_22055) | 535270..535521 | + | 252 | WP_110866812.1 | regulatory protein YcgZ | - |
P6287_RS22060 (P6287_22060) | 535639..535929 | + | 291 | WP_101761585.1 | hypothetical protein | - |
P6287_RS22065 (P6287_22065) | 536137..536487 | - | 351 | WP_277975039.1 | DUF3147 family protein | - |
P6287_RS22070 (P6287_22070) | 536514..537377 | - | 864 | WP_277975040.1 | substrate-binding domain-containing protein | - |
P6287_RS22075 (P6287_22075) | 537500..538141 | - | 642 | WP_277975041.1 | LysE family translocator | - |
P6287_RS22080 (P6287_22080) | 538367..538720 | - | 354 | WP_192234707.1 | DUF1428 domain-containing protein | - |
P6287_RS22085 (P6287_22085) | 538815..539585 | + | 771 | WP_277975042.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | hcp/tssD | 1..771939 | 771939 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13849.13 Da Isoelectric Point: 10.2013
>T275695 WP_192413132.1 NZ_CP121109:c534995-534612 [Pantoea sp. X85]
MAIYVLKPFDRNTKGDAINSAKLCKAALEVMAGIYEASFGRGVYKKRIPLVAGKSGGARAVVAFKTEKHLFFVNGYAKSA
FKSSGREISESDLALYKEVAKQLFEMTSEQAKVAINTGKMREVKCDG
MAIYVLKPFDRNTKGDAINSAKLCKAALEVMAGIYEASFGRGVYKKRIPLVAGKSGGARAVVAFKTEKHLFFVNGYAKSA
FKSSGREISESDLALYKEVAKQLFEMTSEQAKVAINTGKMREVKCDG
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|