Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2698156..2698787 | Replicon | chromosome |
Accession | NZ_CP121108 | ||
Organism | Pantoea sp. X85 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | P6287_RS12500 | Protein ID | WP_217548660.1 |
Coordinates | 2698389..2698787 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | P6287_RS12495 | Protein ID | WP_101763423.1 |
Coordinates | 2698156..2698389 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6287_RS12490 (P6287_12490) | 2695013..2698084 | + | 3072 | WP_277973805.1 | multidrug efflux RND transporter permease subunit MdtC | - |
P6287_RS12495 (P6287_12495) | 2698156..2698389 | + | 234 | WP_101763423.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
P6287_RS12500 (P6287_12500) | 2698389..2698787 | + | 399 | WP_217548660.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
P6287_RS12505 (P6287_12505) | 2698804..2700210 | + | 1407 | WP_192411522.1 | multidrug transporter subunit MdtD | - |
P6287_RS12510 (P6287_12510) | 2700207..2701592 | + | 1386 | WP_101763347.1 | two-component system sensor histidine kinase BaeS | - |
P6287_RS12515 (P6287_12515) | 2701602..2702309 | + | 708 | WP_101763346.1 | two-component system response regulator BaeR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15048.31 Da Isoelectric Point: 8.1127
>T275692 WP_217548660.1 NZ_CP121108:2698389-2698787 [Pantoea sp. X85]
MHRYMLDTHIVIYVIKRRPIEVLERFNANVGRMVISTITLAELFHGSEKSAFPERNLRTVEDFVSRLDVLNYDAKAAFHY
GAIRAELEKNGTPIGLNDLHIAAHARSAALTLVSNNLREFSRVNGLICENWI
MHRYMLDTHIVIYVIKRRPIEVLERFNANVGRMVISTITLAELFHGSEKSAFPERNLRTVEDFVSRLDVLNYDAKAAFHY
GAIRAELEKNGTPIGLNDLHIAAHARSAALTLVSNNLREFSRVNGLICENWI
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|