Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 2603147..2603737 | Replicon | chromosome |
| Accession | NZ_CP121108 | ||
| Organism | Pantoea sp. X85 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | P6287_RS12105 | Protein ID | WP_277973770.1 |
| Coordinates | 2603147..2603479 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | P6287_RS12110 | Protein ID | WP_075808466.1 |
| Coordinates | 2603480..2603737 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6287_RS12085 (P6287_12085) | 2598308..2599339 | - | 1032 | WP_101763421.1 | ABC transporter permease | - |
| P6287_RS12090 (P6287_12090) | 2599354..2600838 | - | 1485 | WP_101763420.1 | sugar ABC transporter ATP-binding protein | - |
| P6287_RS12095 (P6287_12095) | 2600872..2601795 | - | 924 | WP_110866691.1 | sugar ABC transporter substrate-binding protein | - |
| P6287_RS12105 (P6287_12105) | 2603147..2603479 | - | 333 | WP_277973770.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| P6287_RS12110 (P6287_12110) | 2603480..2603737 | - | 258 | WP_075808466.1 | antitoxin | Antitoxin |
| P6287_RS12115 (P6287_12115) | 2604155..2605459 | - | 1305 | WP_277973771.1 | NtaA/DmoA family FMN-dependent monooxygenase | - |
| P6287_RS12120 (P6287_12120) | 2605471..2606670 | - | 1200 | WP_277973772.1 | M20 family metallopeptidase | - |
| P6287_RS12125 (P6287_12125) | 2606768..2607424 | - | 657 | WP_192233454.1 | methionine ABC transporter permease | - |
| P6287_RS12130 (P6287_12130) | 2607405..2608535 | - | 1131 | WP_277973773.1 | ATP-binding cassette domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11782.57 Da Isoelectric Point: 9.3417
>T275691 WP_277973770.1 NZ_CP121108:c2603479-2603147 [Pantoea sp. X85]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNTLTRLPVVVPVTSGGNFAREAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNTLTRLPVVVPVTSGGNFAREAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|