Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1108486..1109106 Replicon chromosome
Accession NZ_CP121108
Organism Pantoea sp. X85

Toxin (Protein)


Gene name Hha Uniprot ID J2UI73
Locus tag P6287_RS05040 Protein ID WP_007886938.1
Coordinates 1108486..1108704 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J3DFW0
Locus tag P6287_RS05045 Protein ID WP_007886936.1
Coordinates 1108729..1109106 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6287_RS05010 (P6287_05010) 1104267..1104605 + 339 WP_007886947.1 P-II family nitrogen regulator -
P6287_RS05015 (P6287_05015) 1104639..1105928 + 1290 WP_101762414.1 ammonium transporter AmtB -
P6287_RS05020 (P6287_05020) 1105999..1106862 - 864 WP_101762413.1 acyl-CoA thioesterase II -
P6287_RS05025 (P6287_05025) 1107068..1107625 + 558 WP_110867736.1 YbaY family lipoprotein -
P6287_RS05030 (P6287_05030) 1107771..1108082 - 312 WP_101762411.1 MGMT family protein -
P6287_RS05040 (P6287_05040) 1108486..1108704 - 219 WP_007886938.1 HHA domain-containing protein Toxin
P6287_RS05045 (P6287_05045) 1108729..1109106 - 378 WP_007886936.1 Hha toxicity modulator TomB Antitoxin
P6287_RS05050 (P6287_05050) 1109254..1109607 - 354 WP_101762410.1 hypothetical protein -
P6287_RS05055 (P6287_05055) 1109948..1110604 + 657 WP_277974599.1 ABC transporter ATP-binding protein -
P6287_RS05060 (P6287_05060) 1110601..1111440 + 840 WP_101762408.1 metal ABC transporter permease -
P6287_RS05065 (P6287_05065) 1111463..1112341 + 879 WP_277974600.1 metal ABC transporter substrate-binding protein -
P6287_RS05070 (P6287_05070) 1112386..1112526 - 141 WP_008103894.1 type B 50S ribosomal protein L36 -
P6287_RS05075 (P6287_05075) 1112542..1112799 - 258 WP_101762406.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8594.98 Da        Isoelectric Point: 9.5023

>T275690 WP_007886938.1 NZ_CP121108:c1108704-1108486 [Pantoea sp. X85]
MSNQALTKTDYLMRLRRCRSIDTLERVIEKNKYELPDNELAVFYSAADHRLAELTMNKLYDKVPVSVWKFVR

Download         Length: 219 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 14743.36 Da        Isoelectric Point: 4.4069

>AT275690 WP_007886936.1 NZ_CP121108:c1109106-1108729 [Pantoea sp. X85]
MDEYSPKRHDIAQLKYLCENLFDESMATLTDSHHGWVNDPTSESNLQLNDLIEHIASFTMNYKIKHVEDEALITQIDEYL
DDTFMLFSSYGINTQDLQRWQRSAKRLFNLFAEECAYLQQPSHSF

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2M9WAL0

Antitoxin

Source ID Structure
AlphaFold DB J3DFW0

References