Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 145386..146029 | Replicon | plasmid p167kb |
Accession | NZ_CP121088 | ||
Organism | Escherichia coli strain ST3 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | P5670_RS24770 | Protein ID | WP_001034044.1 |
Coordinates | 145613..146029 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | P5670_RS24765 | Protein ID | WP_001261286.1 |
Coordinates | 145386..145616 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5670_RS24750 (140523) | 140523..140753 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
P5670_RS24755 (140750) | 140750..141166 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
P5670_RS24760 (141211) | 141211..145005 | - | 3795 | WP_001144731.1 | hypothetical protein | - |
P5670_RS24765 (145386) | 145386..145616 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
P5670_RS24770 (145613) | 145613..146029 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P5670_RS24775 (146104) | 146104..147669 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
P5670_RS24780 (147654) | 147654..148676 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
P5670_RS24790 (149983) | 149983..150897 | + | 915 | WP_000949004.1 | iron/manganese ABC transporter substrate-binding protein SitA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / qnrS1 / blaTEM-1B / sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iucA / iucB / iucC / iucD / iutA | 1..167740 | 167740 | |
- | flank | IS/Tn | sitABCD | - | 148930..153432 | 4502 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T275686 WP_001034044.1 NZ_CP121088:145613-146029 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |