Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 140523..141166 Replicon plasmid p167kb
Accession NZ_CP121088
Organism Escherichia coli strain ST3

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag P5670_RS24755 Protein ID WP_001034046.1
Coordinates 140750..141166 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag P5670_RS24750 Protein ID WP_001261278.1
Coordinates 140523..140753 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5670_RS24720 (136033) 136033..136338 - 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -
P5670_RS24725 (136340) 136340..136558 - 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
P5670_RS24730 (137126) 137126..137638 + 513 WP_000151784.1 hypothetical protein -
P5670_RS24735 (137672) 137672..138805 - 1134 WP_000545984.1 DUF3800 domain-containing protein -
P5670_RS24740 (138972) 138972..139745 - 774 WP_000905949.1 hypothetical protein -
P5670_RS24745 (139758) 139758..140258 - 501 WP_000528932.1 HEPN family nuclease -
P5670_RS24750 (140523) 140523..140753 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
P5670_RS24755 (140750) 140750..141166 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
P5670_RS24760 (141211) 141211..145005 - 3795 WP_001144731.1 hypothetical protein -
P5670_RS24765 (145386) 145386..145616 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
P5670_RS24770 (145613) 145613..146029 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / qnrS1 / blaTEM-1B / sitABCD iroB / iroC / iroD / iroE / iroN / vat / iucA / iucB / iucC / iucD / iutA 1..167740 167740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T275685 WP_001034046.1 NZ_CP121088:140750-141166 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT275685 WP_001261278.1 NZ_CP121088:140523-140753 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References