Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 140523..141166 | Replicon | plasmid p167kb |
| Accession | NZ_CP121088 | ||
| Organism | Escherichia coli strain ST3 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | C7S9Y5 |
| Locus tag | P5670_RS24755 | Protein ID | WP_001034046.1 |
| Coordinates | 140750..141166 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | V0SR71 |
| Locus tag | P5670_RS24750 | Protein ID | WP_001261278.1 |
| Coordinates | 140523..140753 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5670_RS24720 (136033) | 136033..136338 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | - |
| P5670_RS24725 (136340) | 136340..136558 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| P5670_RS24730 (137126) | 137126..137638 | + | 513 | WP_000151784.1 | hypothetical protein | - |
| P5670_RS24735 (137672) | 137672..138805 | - | 1134 | WP_000545984.1 | DUF3800 domain-containing protein | - |
| P5670_RS24740 (138972) | 138972..139745 | - | 774 | WP_000905949.1 | hypothetical protein | - |
| P5670_RS24745 (139758) | 139758..140258 | - | 501 | WP_000528932.1 | HEPN family nuclease | - |
| P5670_RS24750 (140523) | 140523..140753 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| P5670_RS24755 (140750) | 140750..141166 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P5670_RS24760 (141211) | 141211..145005 | - | 3795 | WP_001144731.1 | hypothetical protein | - |
| P5670_RS24765 (145386) | 145386..145616 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| P5670_RS24770 (145613) | 145613..146029 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / qnrS1 / blaTEM-1B / sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iucA / iucB / iucC / iucD / iutA | 1..167740 | 167740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T275685 WP_001034046.1 NZ_CP121088:140750-141166 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9NXF9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SR71 |