Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 136033..136558 | Replicon | plasmid p167kb |
Accession | NZ_CP121088 | ||
Organism | Escherichia coli strain ST3 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | P5670_RS24720 | Protein ID | WP_001159868.1 |
Coordinates | 136033..136338 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | P5670_RS24725 | Protein ID | WP_000813634.1 |
Coordinates | 136340..136558 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5670_RS24705 (131965) | 131965..133131 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
P5670_RS24710 (133719) | 133719..134474 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
P5670_RS24715 (135226) | 135226..136032 | - | 807 | WP_000016982.1 | site-specific integrase | - |
P5670_RS24720 (136033) | 136033..136338 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
P5670_RS24725 (136340) | 136340..136558 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
P5670_RS24730 (137126) | 137126..137638 | + | 513 | WP_000151784.1 | hypothetical protein | - |
P5670_RS24735 (137672) | 137672..138805 | - | 1134 | WP_000545984.1 | DUF3800 domain-containing protein | - |
P5670_RS24740 (138972) | 138972..139745 | - | 774 | WP_000905949.1 | hypothetical protein | - |
P5670_RS24745 (139758) | 139758..140258 | - | 501 | WP_000528932.1 | HEPN family nuclease | - |
P5670_RS24750 (140523) | 140523..140753 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
P5670_RS24755 (140750) | 140750..141166 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / qnrS1 / blaTEM-1B / sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iucA / iucB / iucC / iucD / iutA | 1..167740 | 167740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T275684 WP_001159868.1 NZ_CP121088:c136338-136033 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|