Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4095461..4096115 | Replicon | chromosome |
Accession | NZ_CP121087 | ||
Organism | Escherichia coli strain ST3 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | P5670_RS20015 | Protein ID | WP_000244781.1 |
Coordinates | 4095708..4096115 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | P5670_RS20010 | Protein ID | WP_000354046.1 |
Coordinates | 4095461..4095727 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5670_RS19985 (4090621) | 4090621..4091364 | + | 744 | WP_000951966.1 | SDR family oxidoreductase | - |
P5670_RS19990 (4091421) | 4091421..4092854 | - | 1434 | WP_001605840.1 | 6-phospho-beta-glucosidase BglA | - |
P5670_RS19995 (4092899) | 4092899..4093210 | + | 312 | WP_001182943.1 | N(4)-acetylcytidine aminohydrolase | - |
P5670_RS20000 (4093374) | 4093374..4094033 | + | 660 | WP_000250283.1 | hemolysin III family protein | - |
P5670_RS20005 (4094229) | 4094229..4095209 | - | 981 | WP_000886102.1 | tRNA-modifying protein YgfZ | - |
P5670_RS20010 (4095461) | 4095461..4095727 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
P5670_RS20015 (4095708) | 4095708..4096115 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
P5670_RS20020 (4096155) | 4096155..4096676 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
P5670_RS20025 (4096788) | 4096788..4097684 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
P5670_RS20030 (4097709) | 4097709..4098419 | + | 711 | WP_000715223.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P5670_RS20035 (4098425) | 4098425..4100158 | + | 1734 | WP_000813232.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T275678 WP_000244781.1 NZ_CP121087:4095708-4096115 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|