Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3986737..3987535 | Replicon | chromosome |
Accession | NZ_CP121087 | ||
Organism | Escherichia coli strain ST3 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A1M0HL60 |
Locus tag | P5670_RS19430 | Protein ID | WP_000854692.1 |
Coordinates | 3986737..3987114 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A1L4NTN5 |
Locus tag | P5670_RS19435 | Protein ID | WP_001605875.1 |
Coordinates | 3987161..3987535 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5670_RS19400 (3981864) | 3981864..3983012 | - | 1149 | WP_000905931.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
P5670_RS19405 (3983084) | 3983084..3984067 | - | 984 | WP_001298261.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
P5670_RS19410 (3984878) | 3984878..3985048 | - | 171 | Protein_3791 | IS110 family transposase | - |
P5670_RS19415 (3985391) | 3985391..3986233 | - | 843 | WP_001529559.1 | DUF4942 domain-containing protein | - |
P5670_RS19420 (3986318) | 3986318..3986515 | - | 198 | WP_023563519.1 | DUF957 domain-containing protein | - |
P5670_RS19425 (3986591) | 3986591..3986740 | - | 150 | Protein_3794 | DUF5983 family protein | - |
P5670_RS19430 (3986737) | 3986737..3987114 | - | 378 | WP_000854692.1 | TA system toxin CbtA family protein | Toxin |
P5670_RS19435 (3987161) | 3987161..3987535 | - | 375 | WP_001605875.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
P5670_RS19440 (3987615) | 3987615..3987836 | - | 222 | WP_000692303.1 | DUF987 domain-containing protein | - |
P5670_RS19445 (3987905) | 3987905..3988381 | - | 477 | WP_001605874.1 | RadC family protein | - |
P5670_RS19450 (3988397) | 3988397..3988876 | - | 480 | WP_001605873.1 | antirestriction protein | - |
P5670_RS19455 (3988958) | 3988958..3989776 | - | 819 | WP_001605871.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14119.12 Da Isoelectric Point: 7.3249
>T275677 WP_000854692.1 NZ_CP121087:c3987114-3986737 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWHTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ
MKTLPDTHVREASCCPSPVTIWHTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13594.42 Da Isoelectric Point: 5.4554
>AT275677 WP_001605875.1 NZ_CP121087:c3987535-3987161 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLACEADTLGSCGYVYMAVYPTLAPATTS
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLACEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0HL60 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1L4NTN5 |