Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 3299547..3300159 | Replicon | chromosome |
Accession | NZ_CP121087 | ||
Organism | Escherichia coli strain ST3 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | U9YXE2 |
Locus tag | P5670_RS16045 | Protein ID | WP_000833473.1 |
Coordinates | 3299547..3299732 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | L4IWR9 |
Locus tag | P5670_RS16050 | Protein ID | WP_000499744.1 |
Coordinates | 3299749..3300159 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5670_RS16035 (3296379) | 3296379..3297530 | + | 1152 | WP_000741501.1 | L-threonine dehydrogenase | - |
P5670_RS16040 (3297731) | 3297731..3299269 | + | 1539 | WP_001309845.1 | aldehyde dehydrogenase AldB | - |
P5670_RS16045 (3299547) | 3299547..3299732 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
P5670_RS16050 (3299749) | 3299749..3300159 | + | 411 | WP_000499744.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
P5670_RS16055 (3300231) | 3300231..3302195 | - | 1965 | WP_001026861.1 | glycoside hydrolase family 127 protein | - |
P5670_RS16060 (3302206) | 3302206..3303606 | - | 1401 | WP_000204802.1 | MFS transporter | - |
P5670_RS16065 (3303832) | 3303832..3304647 | + | 816 | WP_000891825.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T275673 WP_000833473.1 NZ_CP121087:3299547-3299732 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15241.15 Da Isoelectric Point: 4.5486
>AT275673 WP_000499744.1 NZ_CP121087:3299749-3300159 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|