Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 2579571..2580166 | Replicon | chromosome |
Accession | NZ_CP121087 | ||
Organism | Escherichia coli strain ST3 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | - |
Locus tag | P5670_RS12745 | Protein ID | WP_024190283.1 |
Coordinates | 2579571..2579921 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | P5670_RS12750 | Protein ID | WP_001223213.1 |
Coordinates | 2579915..2580166 (-) | Length | 84 a.a. |
Genomic Context
Location: 2578962..2579492 (531 bp)
Type: Others
Protein ID: WP_000055075.1
Type: Others
Protein ID: WP_000055075.1
Location: 2574945..2575967 (1023 bp)
Type: Others
Protein ID: WP_001298067.1
Type: Others
Protein ID: WP_001298067.1
Location: 2575981..2577483 (1503 bp)
Type: Others
Protein ID: WP_001605422.1
Type: Others
Protein ID: WP_001605422.1
Location: 2577696..2578652 (957 bp)
Type: Others
Protein ID: WP_000265933.1
Type: Others
Protein ID: WP_000265933.1
Location: 2579571..2579921 (351 bp)
Type: Toxin
Protein ID: WP_024190283.1
Type: Toxin
Protein ID: WP_024190283.1
Location: 2579915..2580166 (252 bp)
Type: Antitoxin
Protein ID: WP_001223213.1
Type: Antitoxin
Protein ID: WP_001223213.1
Location: 2580378..2580719 (342 bp)
Type: Others
Protein ID: WP_001219160.1
Type: Others
Protein ID: WP_001219160.1
Location: 2580722..2584501 (3780 bp)
Type: Others
Protein ID: WP_000060904.1
Type: Others
Protein ID: WP_000060904.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5670_RS12725 (2574945) | 2574945..2575967 | - | 1023 | WP_001298067.1 | ABC transporter permease | - |
P5670_RS12730 (2575981) | 2575981..2577483 | - | 1503 | WP_001605422.1 | sugar ABC transporter ATP-binding protein | - |
P5670_RS12735 (2577696) | 2577696..2578652 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
P5670_RS12740 (2578962) | 2578962..2579492 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
P5670_RS12745 (2579571) | 2579571..2579921 | - | 351 | WP_024190283.1 | endoribonuclease toxin ChpB | Toxin |
P5670_RS12750 (2579915) | 2579915..2580166 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
P5670_RS12755 (2580378) | 2580378..2580719 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
P5670_RS12760 (2580722) | 2580722..2584501 | - | 3780 | WP_000060904.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12423.38 Da Isoelectric Point: 6.2206
>T275671 WP_024190283.1 NZ_CP121087:c2579921-2579571 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMALVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMALVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | L4JJX7 |