Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 2469839..2470653 | Replicon | chromosome |
Accession | NZ_CP121087 | ||
Organism | Escherichia coli strain ST3 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | P5670_RS12170 | Protein ID | WP_001054376.1 |
Coordinates | 2469839..2470096 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | P5670_RS12175 | Protein ID | WP_001309181.1 |
Coordinates | 2470108..2470653 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5670_RS12145 (2465127) | 2465127..2466233 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
P5670_RS12150 (2466298) | 2466298..2467278 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
P5670_RS12155 (2467388) | 2467388..2467593 | + | 206 | Protein_2385 | HNH endonuclease | - |
P5670_RS12160 (2467861) | 2467861..2469101 | - | 1241 | Protein_2386 | helicase YjhR | - |
P5670_RS12165 (2469217) | 2469217..2469348 | + | 132 | WP_001309182.1 | hypothetical protein | - |
P5670_RS12170 (2469839) | 2469839..2470096 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
P5670_RS12175 (2470108) | 2470108..2470653 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
P5670_RS12180 (2470709) | 2470709..2471455 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
P5670_RS12185 (2471624) | 2471624..2471842 | + | 219 | Protein_2391 | hypothetical protein | - |
P5670_RS12190 (2471880) | 2471880..2471996 | + | 117 | Protein_2392 | VOC family protein | - |
P5670_RS12195 (2472241) | 2472241..2473362 | + | 1122 | WP_277967484.1 | M42 family metallopeptidase | - |
P5670_RS12200 (2473359) | 2473359..2473637 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
P5670_RS12205 (2473649) | 2473649..2474962 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimB | 2462333..2478877 | 16544 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T275669 WP_001054376.1 NZ_CP121087:2469839-2470096 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT275669 WP_001309181.1 NZ_CP121087:2470108-2470653 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|