Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 1320492..1321197 | Replicon | chromosome |
Accession | NZ_CP121087 | ||
Organism | Escherichia coli strain ST3 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | P5670_RS06635 | Protein ID | WP_000539521.1 |
Coordinates | 1320492..1320878 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | P5670_RS06640 | Protein ID | WP_001280945.1 |
Coordinates | 1320868..1321197 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5670_RS06615 (1316496) | 1316496..1317122 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
P5670_RS06620 (1317119) | 1317119..1318234 | - | 1116 | WP_000555038.1 | aldose sugar dehydrogenase YliI | - |
P5670_RS06625 (1318345) | 1318345..1318728 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
P5670_RS06630 (1318941) | 1318941..1320266 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
P5670_RS06635 (1320492) | 1320492..1320878 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P5670_RS06640 (1320868) | 1320868..1321197 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
P5670_RS06645 (1321267) | 1321267..1322595 | - | 1329 | WP_000086879.1 | GGDEF domain-containing protein | - |
P5670_RS06650 (1322603) | 1322603..1324951 | - | 2349 | WP_001322378.1 | EAL domain-containing protein | - |
P5670_RS06655 (1325129) | 1325129..1326040 | - | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T275661 WP_000539521.1 NZ_CP121087:1320492-1320878 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|