Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1073285..1074069 | Replicon | chromosome |
Accession | NZ_CP121087 | ||
Organism | Escherichia coli strain ST3 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | P5670_RS05465 | Protein ID | WP_000613626.1 |
Coordinates | 1073575..1074069 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | L4JCW6 |
Locus tag | P5670_RS05460 | Protein ID | WP_001110447.1 |
Coordinates | 1073285..1073578 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5670_RS05450 (1068435) | 1068435..1069394 | - | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
P5670_RS05455 (1069967) | 1069967..1073152 | + | 3186 | WP_000827427.1 | ribonuclease E | - |
P5670_RS05460 (1073285) | 1073285..1073578 | + | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
P5670_RS05465 (1073575) | 1073575..1074069 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
P5670_RS05470 (1074164) | 1074164..1075117 | - | 954 | WP_001212768.1 | flagellar hook-associated protein FlgL | - |
P5670_RS05475 (1075129) | 1075129..1076772 | - | 1644 | WP_000096524.1 | flagellar hook-associated protein FlgK | - |
P5670_RS05480 (1076838) | 1076838..1077779 | - | 942 | WP_001309406.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
P5670_RS05485 (1077779) | 1077779..1078876 | - | 1098 | WP_000589320.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T275660 WP_000613626.1 NZ_CP121087:1073575-1074069 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|