Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 728012..728650 | Replicon | chromosome |
Accession | NZ_CP121087 | ||
Organism | Escherichia coli strain ST3 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | B7N4J4 |
Locus tag | P5670_RS03660 | Protein ID | WP_000813797.1 |
Coordinates | 728474..728650 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | P5670_RS03655 | Protein ID | WP_076611057.1 |
Coordinates | 728012..728428 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5670_RS03635 (723164) | 723164..724105 | - | 942 | WP_001251335.1 | ABC transporter permease | - |
P5670_RS03640 (724106) | 724106..725119 | - | 1014 | WP_000220413.1 | ABC transporter ATP-binding protein | - |
P5670_RS03645 (725137) | 725137..726282 | - | 1146 | WP_000047447.1 | ABC transporter substrate-binding protein | - |
P5670_RS03650 (726527) | 726527..727933 | - | 1407 | WP_000760613.1 | PLP-dependent aminotransferase family protein | - |
P5670_RS03655 (728012) | 728012..728428 | - | 417 | WP_076611057.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
P5670_RS03660 (728474) | 728474..728650 | - | 177 | WP_000813797.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
P5670_RS03665 (728872) | 728872..729102 | + | 231 | WP_000494244.1 | YncJ family protein | - |
P5670_RS03670 (729194) | 729194..731155 | - | 1962 | WP_001309488.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
P5670_RS03675 (731228) | 731228..731764 | - | 537 | WP_000429161.1 | DNA-binding transcriptional regulator SutR | - |
P5670_RS03680 (731856) | 731856..733028 | + | 1173 | WP_001236223.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6724.76 Da Isoelectric Point: 11.5666
>T275659 WP_000813797.1 NZ_CP121087:c728650-728474 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15251.65 Da Isoelectric Point: 4.5908
>AT275659 WP_076611057.1 NZ_CP121087:c728428-728012 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|