Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 14531..15121 | Replicon | plasmid pR22.3740_195k |
| Accession | NZ_CP121077 | ||
| Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.3740 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A241PXU0 |
| Locus tag | P8I06_RS23745 | Protein ID | WP_023994178.1 |
| Coordinates | 14789..15121 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A5T3Q5H6 |
| Locus tag | P8I06_RS23740 | Protein ID | WP_023994179.1 |
| Coordinates | 14531..14788 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8I06_RS23720 (P8I06_23720) | 10030..11055 | + | 1026 | WP_023994180.1 | IS630 family transposase | - |
| P8I06_RS23725 (P8I06_23725) | 11059..12078 | - | 1020 | WP_223155817.1 | hypothetical protein | - |
| P8I06_RS23730 (P8I06_23730) | 12218..12724 | - | 507 | WP_223155815.1 | hypothetical protein | - |
| P8I06_RS23735 (P8I06_23735) | 12835..13920 | - | 1086 | WP_223155813.1 | hypothetical protein | - |
| P8I06_RS23740 (P8I06_23740) | 14531..14788 | + | 258 | WP_023994179.1 | hypothetical protein | Antitoxin |
| P8I06_RS23745 (P8I06_23745) | 14789..15121 | + | 333 | WP_023994178.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| P8I06_RS23750 (P8I06_23750) | 15721..16326 | + | 606 | Protein_14 | IS481 family transposase | - |
| P8I06_RS23755 (P8I06_23755) | 16625..18847 | - | 2223 | WP_242211999.1 | DEAD/DEAH box helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | floR / aph(4)-Ia / aac(3)-IVa / dfrA14 / aph(3')-Ia | faeC / faeD / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS | 1..195315 | 195315 | |
| - | inside | IScluster/Tn | - | - | 10018..16326 | 6308 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11787.54 Da Isoelectric Point: 9.3417
>T275649 WP_023994178.1 NZ_CP121077:14789-15121 [Salmonella enterica subsp. enterica serovar Infantis]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGDFARTAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPEAVVNEVLARLEAILS
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGDFARTAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPEAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A241PXU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5T3Q5H6 |